PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D05G2531
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bHLH
Protein Properties Length: 478aa    MW: 54766.3 Da    PI: 4.7985
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D05G2531genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH13.30.00015277310842
                  HHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHH CS
          HLH   8 rErrRRdriNsafeeLrellPkaskapskKlsKae 42 
                  +E +R +++N+afe Lr+   ++ +++++K  Ka+
  Gh_D05G2531 277 VESKRIKKVNDAFEALRKKFNSP-QTDQQKQKKAS 310
                  799***************99996.56777777764 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5177444.5421191IPR011684Protein Networked (NET), actin-binding (NAB) domain
PfamPF077656.7E-351285IPR011684Protein Networked (NET), actin-binding (NAB) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003779Molecular Functionactin binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MMLQKVASNA YSWWWASHIR TKQSKWLEQN LHDVEEKVSN MLEIIDDDGD SFAQRANMYY  60
RKRPELLAIV EDTYRAYRAL AERFDYLSRD LQSANRTIAT VFPDQVPYSL HDEDDENSCL  120
VSTSSSLNKS KSLKPGSRVP SPKTDFRSQS MLLLRKGQLK KAFSSAQAAS SLNSGLSKEE  180
ALEEINKLQK EILEMQTERE LVKNSYEQGY KKLCEIENDI TEKQKRIYSL QDEYDIRSAI  240
DDNEARILMA NRVLKTCQES LVKLQETHEQ STEEGRVESK RIKKVNDAFE ALRKKFNSPQ  300
TDQQKQKKAS SARDVDNMVY EFNSAEKGRE YMELLQKEIE EKLELDSSSS LTMSQLADKI  360
DDLVQRVVNM ETAVFSENAS VKRLKSDADE LQEHVKSLEE DEEVLAEGSD SMEQRISVLE  420
GELSGVKELL KTIIEQNNSL KAHFTAASCD INHLSVNLHA VKMDEEVENA ELSKEGKP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447896.10.0PREDICTED: protein NETWORKED 2A-like
SwissprotP0DMS11e-142NET2A_ARATH; Protein NETWORKED 2A
TrEMBLA0A0D2UV260.0A0A0D2UV26_G
STRINGPOPTR_0002s10660.11e-149(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM416934